PDB entry 2q76

View 2q76 on RCSB PDB site
Description: Mouse anti-hen egg white lysozyme antibody F10.6.6 Fab fragment
Class: immune system
Keywords: Antibody, Fab fragment, lysozyme, affinity maturation, VH-VL interface., IMMUNE SYSTEM
Deposited on 2007-06-06, released 2008-03-18
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-18, with a file datestamp of 2008-03-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab F10.6.6 fragment Light Chain
    Species: Mus musculus
  • Chain 'B':
    Compound: Fab F10.6.6 fragment Heavy Chain
    Species: Mus musculus
    Domains in SCOP 1.75: d2q76b1
  • Chain 'C':
    Compound: Fab F10.6.6 fragment Light Chain
    Species: Mus musculus
  • Chain 'D':
    Compound: Fab F10.6.6 fragment Heavy Chain
    Species: Mus musculus
    Domains in SCOP 1.75: d2q76d1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q76B (B:)
    evqleqsgaelmkpgasvkisckatgytfttywiewikqrpghslewigeilpgsdstyy
    nekvkgkvtftadassntaymqlssltsedsavyycargdgfyvywgqgttltvssastt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsspwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q76B (B:)
    evqleqsgaelmkpgasvkisckatgytfttywiewikqrpghslewigeilpgsdstyy
    nekvkgkvtftadassntaymqlssltsedsavyycargdgfyvywgqgttltvssastt
    ppsvyplapgqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
    vtvpsspwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q76D (D:)
    evqleqsgaelmkpgasvkisckatgytfttywiewikqrpghslewigeilpgsdstyy
    nekvkgkvtftadassntaymqlssltsedsavyycargdgfyvywgqgttltvssastt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsspwpsetvtcnvahpasstkvdkkivpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q76D (D:)
    evqleqsgaelmkpgasvkisckatgytfttywiewikqrpghslewigeilpgsdstyy
    nekvkgkvtftadassntaymqlssltsedsavyycargdgfyvywgqgttltvssastt
    ppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtv
    psspwpsetvtcnvahpasstkvdkkivpr