PDB entry 2q70

View 2q70 on RCSB PDB site
Description: Estrogen receptor alpha ligand-binding domain complxed to a benzopyran ligand
Class: transcription
Keywords: transcription factor, estrogen receptor
Deposited on 2007-06-05, released 2007-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.26
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (77)
      • engineered (113)
    Domains in SCOPe 2.07: d2q70a_
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (77)
      • engineered (113)
    Domains in SCOPe 2.07: d2q70b_
  • Heterogens: DC8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q70A (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q70A (A:)
    lalsltadqmvsalldaeppilyseydpseasmmglltnladrelvhminwakrvpgfvd
    ltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysmvplydlllemldahrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q70B (B:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q70B (B:)
    lalsltadqmvsalldaeppilysesmmglltnladrelvhminwakrvpgfvdltlhdq
    vhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatssrf
    rmmnlqgeefvclksiillnsgvytfstlksleekdhihrvldkitdtlihlmakagltl
    qqqhqrlaqlllilshirhmsnkgmehlysm