PDB entry 2q6z

View 2q6z on RCSB PDB site
Description: Uroporphyrinogen Decarboxylase G168R single mutant apo-enzyme
Class: lyase
Keywords: Uroporphyrinogen Decarboxylase enzyme UROD G168R coproporphyrinogen, LYASE
Deposited on 2007-06-05, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uroporphyrinogen decarboxylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UROD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06132 (0-355)
      • engineered (157)
    Domains in SCOPe 2.07: d2q6za_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q6zA (A:)
    fpelkndtflraawgeetdytpvwcmrqagrylpefretraaqdffstcrspeacceltl
    qplrrfpldaaiifsdilvvpqalgmevtmvpgkgpsfpeplreeqdlerlrdpevvase
    lgyvfqaitltrqrlagrvpligfagapwtlmtymverggsstmaqakrwlyqrpqashq
    llriltdalvpylvgqvvagaqalqlfeshaghlgpqlfnkfalpyirdvakqvkarlre
    aglapvpmiifakdghfaleelaqagyevvgldwtvapkkarecvgktvtlqgnldpcal
    yaseeeigqlvkqmlddfgphryianlghglypdmdpehvgafvdavhkhsrllrq