PDB entry 2q6k

View 2q6k on RCSB PDB site
Description: SalL with adenosine
Class: biosynthetic protein
Keywords: chlorinase, complex with adenosine, BIOSYNTHETIC PROTEIN
Deposited on 2007-06-05, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.202
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chlorinase
    Species: Salinispora tropica [TaxId:369723]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q6ka1, d2q6ka2
  • Heterogens: ADN, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q6kA (A:)
    mqhnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvphs
    fpahtvicayvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlspdv
    mnqpvtptwygkdivaacaahlaagtdlaavgpridpkqivrlpyasaseveggirgevv
    ridrafgnvwtnipthligsmlqdgerlevkiealsdtvlelpfcktfgevdegqpllyl
    nsrgrlalglnqsnfiekwpvvpgdsitvsprvpdsnlgpvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q6kA (A:)
    mqhnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvphs
    fpahtvicayvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlspdv
    mnqpvtptwygkdivaacaahlaagtdlaavgpridpkqivrlpyasasirgevvridra
    fgnvwtnipthligrlevkilsdtvlelpfcktfgevdegqpllylnsrgrlalglnqsn
    fiekwpvvpgdsitvsp