PDB entry 2q6i

View 2q6i on RCSB PDB site
Description: salL with ClDA and LMet
Class: biosynthetic protein
Keywords: chlorinase, ClDA and L-Met complex, BIOSYNTHETIC PROTEIN
Deposited on 2007-06-05, released 2007-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.209
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Salinispora tropica [TaxId:369723]
    Gene: salL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q6ia1, d2q6ia2
  • Heterogens: 5CD, MET, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q6iA (A:)
    mqhnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvphs
    fpahtvicayvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlspdv
    mnqpvtptwygkdivaacaahlaagtdlaavgpridpkqivrlpyasaseveggirgevv
    ridrafgnvwtnipthligsmlqdgerlevkiealsdtvlelpfcktfgevdegqpllyl
    nsrgrlalglnqsnfiekwpvvpgdsitvsprvpdsnlgpvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q6iA (A:)
    mqhnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvphs
    fpahtvicayvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlspdv
    mnqpvtptwygkdivaacaahlaagtdlaavgpridpkqivrlpyasaseveggirgevv
    ridrafgnvwtnipthligsmrlevkiealsdtvlelpfcktfgevdegqpllylnsrgr
    lalglnqsnfiekwpvvpgdsitvsp