PDB entry 2q63

View 2q63 on RCSB PDB site
Description: HIV-1 PR mutant in complex with nelfinavir
Class: hydrolase
Keywords: resistance; nelfinavir, HYDROLASE
Deposited on 2007-06-04, released 2008-02-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (29)
    • engineered (54)
    • engineered (89)
  Domains in SCOPe 2.01: d2q63a_
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (29)
    • engineered (54)
    • engineered (89)
  Domains in SCOPe 2.01: d2q63b_
• Heterogens: 1UN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q63A (A:)
  pqitlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfiavrqyd
  qilieicghkaigtvlvgptpvniigrnlmtqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q63B (B:)
  pqitlwqrplvtikiggqlkealldtgadntvleemslpgrwkpkmiggiggfiavrqyd
  qilieicghkaigtvlvgptpvniigrnlmtqigctlnf