PDB entry 2q5w

View 2q5w on RCSB PDB site
Description: The X-ray Crystal Structure of Molybdopterin Synthase from Staphylococcus aureus
Class: transferase
Keywords: MOLYBDOPTERIN, MOCO, MPT SYNTHASE, MOAD, MOAE, TRANSFERASE, MOLYBDENUM COFACTOR BIOSYNTHESIS, beta-Grasp (ubiquitin-like), alpha beta hammerhead fold
Deposited on 2007-06-03, released 2008-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: molybdopterin converting factor, subunit 1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: MoaD
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Molybdopterin-converting factor subunit 2
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: moaE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P65401 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.08: d2q5we1, d2q5we2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >2q5wE (E:)
hmkqfeiviepiqteqyreftineyqgavvvftghvrewtkgvkteyleyeayipmaekk
laqigdeinekwpgtitsivhrigplqisdiavliavssphrkdayraneyaierikeiv
piwkkeiwedgskwqghqkgnyeeakree

    Sequence, based on observed residues (ATOM records): (download) 
    >2q5wE (E:)
hmkqfeiviepiqteqyreftineyqgavvvftghvrewtkgvkteyleyeayipmaekk
laqigdeinekwpgtitsivhrigplqisdiavliavssphrkdayraneyaierikeiv
piwkkeiwedgskwqgh