PDB entry 2q5u

View 2q5u on RCSB PDB site
Description: Crystal structure of IQN17
Class: viral protein
Keywords: envelope glycoprotein, coiled coil, viral protein/viral protein inhibitor
Deposited on 2007-06-01, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.249
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fusion protein between yeast variant GCN4 and HIVgp41
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot A3F986 (27-44)
  Domains in SCOPe 2.08: d2q5ua1
• Chain 'B':
  Compound: Fusion protein between yeast variant GCN4 and HIVgp41
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot A3F986 (27-44)
  Domains in SCOPe 2.08: d2q5ub1
• Chain 'C':
  Compound: Fusion protein between yeast variant GCN4 and HIVgp41
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot A3F986 (27-44)
  Domains in SCOPe 2.08: d2q5uc1
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q5uA (A:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q5uB (B:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q5uC (C:)
  rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril