PDB entry 2q5u
View 2q5u on RCSB PDB site
Description: Crystal structure of IQN17
Class: viral protein
Keywords: envelope glycoprotein, coiled coil, viral protein/viral protein inhibitor
Deposited on
2007-06-01, released
2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.249
AEROSPACI score: 0.61
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fusion protein between yeast variant GCN4 and HIVgp41
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2q5ua1 - Chain 'B':
Compound: Fusion protein between yeast variant GCN4 and HIVgp41
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2q5ub1 - Chain 'C':
Compound: Fusion protein between yeast variant GCN4 and HIVgp41
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2q5uc1 - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2q5uA (A:)
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2q5uB (B:)
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2q5uC (C:)
rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril