PDB entry 2q5u

View 2q5u on RCSB PDB site
Description: Crystal structure of IQN17
Class: viral protein
Keywords: envelope glycoprotein, coiled coil, viral protein/viral protein inhibitor
Deposited on 2007-06-01, released 2007-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.249
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion protein between yeast variant GCN4 and HIVgp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q5ua1
  • Chain 'B':
    Compound: Fusion protein between yeast variant GCN4 and HIVgp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q5ub1
  • Chain 'C':
    Compound: Fusion protein between yeast variant GCN4 and HIVgp41
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q5uc1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q5uA (A:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q5uB (B:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q5uC (C:)
    rmkqiedkieeieskqkkieneiarikkllqltvwgikqlqaril