PDB entry 2q5g

View 2q5g on RCSB PDB site
Description: Ligand binding domain of PPAR delta receptor in complex with a partial agonist
Class: transcription
Keywords: PPAR delta, TRANSCRIPTION
Deposited on 2007-06-01, released 2008-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: HOMO SAPIENS
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q5ga_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: HOMO SAPIENS
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q5gb_
  • Heterogens: 1FA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q5gA (A:)
    hhhhhhgsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdiet
    lwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndq
    vtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkf
    nalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpk
    llqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5gA (A:)
    dlkafskhiynaylknfnmtkkkarsiltgkatapfvihdietlwqaekglvweisvhvf
    yrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllva
    ngsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmn
    vprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikkpllq
    eiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q5gB (B:)
    hhhhhhgsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdiet
    lwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndq
    vtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkf
    nalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpk
    llqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5gB (B:)
    adlkafskhiynaylknfnmtkkkarsiltgapfvihdietlwqaekglvweisvhvfyr
    cqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgllvang
    sgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpglmnvp
    rveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikkt