PDB entry 2q5d

View 2q5d on RCSB PDB site
Description: Crystal Structure of Human Importin Beta bound to the Snurportin1 IBB-domain second crystal form
Class: protein transport
Keywords: heat repeat, ibb-domain, importin, karyopherin, snurportin, protein transport
Deposited on 2007-05-31, released 2008-01-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.303
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin beta-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNB1, NTF97
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2q5da_
  • Chain 'B':
    Compound: importin beta-1 subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNB1, NTF97
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2q5db_
  • Chain 'C':
    Compound: Snurportin-1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2q5dc_
  • Chain 'D':
    Compound: Snurportin-1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2q5dd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q5dA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklknqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5dA (A:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdmvdylnelrescleaytgivqglkgdqenvhp
    dvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvearpmihe
    lltegrrsktnkaktlatwatkelrklknqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q5dB (B:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
    lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
    yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
    alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
    envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
    pmihelltegrrsktnkaktlatwatkelrklknqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5dB (B:)
    melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
    iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
    ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
    mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
    lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
    aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
    ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
    svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
    ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
    kdcypavqkttlvimerlqqvlqmsdriqfndlqsllcatlqnvlrkvqhqdalqisdvv
    masllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgigqvclaavglv
    gdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdialaiggefkkylev
    vlntlqqasqaqvylnelrescleaytgivqgqpdvmlvqprvefilsfidhiagdedht
    dgvvacaagligdlctafgkdvlklvearpmihelltegrrsktnkaktlatwatkelrk
    lknqa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q5dC (C:)
    hprlsqykskyssleqserrrrllelqkskrldyvnharr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5dC (C:)
    prlsqykskyeqserrrrllelqkskrldyvnharr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q5dD (D:)
    hprlsqykskyssleqserrrrllelqkskrldyvnharr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5dD (D:)
    errrrllelqkskrldyvnharr