PDB entry 2q5a

View 2q5a on RCSB PDB site
Description: human Pin1 bound to L-PEPTIDE
Class: isomerase
Keywords: ISOMERASE WW domain
Deposited on 2007-05-31, released 2007-06-26
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-26, with a file datestamp of 2007-06-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.233
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-166)
      • engineered (17)
    Domains in SCOP 1.73: d2q5aa1, d2q5aa2
  • Chain 'B':
    Compound: Five residue peptide
    Species: synthetic, synthetic
  • Heterogens: NH2, 16P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q5aA (A:)
    gshgmadeeklppgwekamsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvr
    cshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssa
    kargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5aA (A:)
    lppgwekamsrssgrvyyfnhitnasqwerpseparvrcshllvkhsqsrrpsswrqeki
    trtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmqkpfedas
    falrtgemsgpvftdsgihiilrte
    

  • Chain 'B':
    No sequence available.