PDB entry 2q5a

View 2q5a on RCSB PDB site
Description: human Pin1 bound to L-PEPTIDE
Class: isomerase/isomerase inhibitor
Keywords: ISOMERASE WW domain, ISOMERASE-ISOMERASE INHIBITOR complex
Deposited on 2007-05-31, released 2007-06-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.233
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-166)
      • engineered mutation (17)
    Domains in SCOPe 2.08: d2q5aa1, d2q5aa2
  • Chain 'B':
    Compound: Five residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q5A (0-End)
  • Heterogens: 16P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q5aA (A:)
    gshgmadeeklppgwekamsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvr
    cshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssa
    kargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q5aA (A:)
    lppgwekamsrssgrvyyfnhitnasqwerpseparvrcshllvkhsqsrrpsswrqeki
    trtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmqkpfedas
    falrtgemsgpvftdsgihiilrte
    

  • Chain 'B':
    No sequence available.