PDB entry 2q4y

View 2q4y on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of At1g77540-coenzyme A complex
Class: transferase
Keywords: Ensemble Refinement, Refinement Methodology Development, CoA, Coenzyme-A, COG2388 Family, acetyltransferase, At1g77540, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, TRANSFERASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein At1g77540
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At1g77540, T5M16.13
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CAQ2
  Domains in SCOPe 2.05: d2q4ya_
• Heterogens: COA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2q4yA (A:)
  mateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
  afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2q4yA (A:)
  ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
  asshsisiipscsyvsdtflprnpswkplih