PDB entry 2q4q

View 2q4q on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Homo sapiens Hs.95870
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, HS.95870, DUF498, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.173
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0366 protein C11orf67
    Species: Homo sapiens [TaxId:9606]
    Gene: C11orf67, PTD015, Hs.503357
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7C9 (1-121)
      • expression tag (0)
      • modified residue (13)
      • modified residue (70)
    Domains in SCOPe 2.08: d2q4qa2, d2q4qa3
  • Chain 'B':
    Compound: UPF0366 protein C11orf67
    Species: Homo sapiens [TaxId:9606]
    Gene: C11orf67, PTD015, Hs.503357
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H7C9 (1-121)
      • expression tag (0)
      • modified residue (13)
      • modified residue (70)
    Domains in SCOPe 2.08: d2q4qb2, d2q4qb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q4qA (A:)
    stspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvek
    gvqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhs
    tc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4qB (B:)
    stspeiaslswgqmkvkgsnttykdckvwpggsrtwdwretgtehspgvqpadvkevvek
    gvqtlvigrgmsealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhs
    tc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4qB (B:)
    stspeiaslswgqmkvkgsnttykdckvwpggsrtwdgvqpadvkevvekgvqtlvigrg
    msealkvpsstveylkkhgidvrvlqteqavkeynalvaqgvrvggvfhstc