PDB entry 2q4o

View 2q4o on RCSB PDB site
Description: Ensemble refinement of the crystal structure of a lysine decarboxylase-like protein from Arabidopsis thaliana gene At2g37210
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT2G37210, LYSINE DECARBOXYLASE-LIKE PROTEIN, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.168
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein At2g37210/T2N18.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g37210, T2N18.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L8B8
      • modified residue (7)
      • modified residue (57)
      • modified residue (80)
      • modified residue (98)
      • modified residue (105)
    Domains in SCOPe 2.07: d2q4oa_
  • Chain 'B':
    Compound: Uncharacterized protein At2g37210/T2N18.3
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g37210, T2N18.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L8B8
      • modified residue (57)
      • modified residue (98)
      • modified residue (105)
    Domains in SCOPe 2.07: d2q4ob_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4oA (A:)
    meikgesmqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmgl
    vsqavhdggrhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggy
    gtleellevitwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsapt
    akelvkkleeyapchervatklcwemerigyssee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4oA (A:)
    mqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhd
    ggrhvigiipktlmvgevravadmhqrkaemakhsdafialpggygtleellevitwaql
    gihdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4oB (B:)
    meikgesmqkskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmgl
    vsqavhdggrhvigiipktlmpreltgetvgevravadmhqrkaemakhsdafialpggy
    gtleellevitwaqlgihdkpvgllnvdgyynsllsfidkaveegfisptareiivsapt
    akelvkkleeyapchervatklcwemerigyssee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4oB (B:)
    kskfrricvfcgssqgkkssyqdaavdlgnelvsrnidlvygggsiglmglvsqavhdgg
    rhvigiipkgetvgevravadmhqrkaemakhsdafialpggygtleellevitwaqlgi
    hdkpvgllnvdgyynsllsfidkaveegfisptareiivsaptakelvkklee