PDB entry 2q4m

View 2q4m on RCSB PDB site
Description: Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At5g01750
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT5G01750, PFAM PF01167, TULP, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.158
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At5g01750
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g01750, T20L15.20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LZX1
      • modified residue (39)
      • modified residue (170)
    Domains in SCOPe 2.08: d2q4ma_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2q4mA (A:)
meqpyvyaypqgsgpsgaptpqaggvvvdpkycapypidmaivrkmmsltdgnfvitdvn
gnllfkvkepvfglhdkrvlldgsgtpvvtlrekmvsmhdrwqvfrggstdqrdllytvk
rssmlqlktkldvflghnkdekrcdfrvkgswlerscvvyagesdaivaqmhrkhtvqsv
flgkdnfsvtvypnvdyafiaslvvilddvnredraa

    Sequence, based on observed residues (ATOM records): (download) 
    >2q4mA (A:)
ggvvvdpkycapypidmaivrkdgnfvitdvngnllfkvkepvfglhdkrvlldgsgtpv
vtlredrwqvfrggstdqrdllytvkrtkldvflghnkdkrcdfrvkgswlerscvvyag
esdaivaqmhrkgkdnfsvtvypnvdyafiaslvvilddvnr