PDB entry 2q4l

View 2q4l on RCSB PDB site
Description: Ensemble refinement of the crystal structure of GALT-like protein from Arabidopsis thaliana At5g18200
Class: transferase
Keywords: Ensemble Refinement, Refinement Methodology Development, GALT, AT5G18200, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, TRANSFERASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable galactose-1-phosphate uridyl transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200, MRG7_16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q4la1, d2q4la2
  • Chain 'B':
    Compound: Probable galactose-1-phosphate uridyl transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g18200, MRG7_16
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q4lb1, d2q4lb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4lA (A:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4lA (A:)
    pelrkdpvtnrwvifspfkskscpfcigreqecapelfrvpdhdpnwklrvienlypals
    rnletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqv
    fknqgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvide
    sshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppy
    nymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevsl
    t
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4lB (B:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifsparakrptdfkskspqnpnpkp
    sscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4lB (B:)
    qspelrkdpvtnrwvifsptdfksscpfciecapelfrvpdhdpnwklrvienlypalsr
    nletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvf
    knqgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvides
    shfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppyn
    ymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevsl