PDB entry 2q4j

View 2q4j on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g03250, a putative UDP-glucose pyrophosphorylase
Class: transferase
Keywords: Ensemble Refinement, Refinement Methodology Development, AT3G03250, PUTATIVE UDP-GLUCOSE PYROPHOSPHORYLASE, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, TRANSFERASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-02, with a file datestamp of 2007-09-28.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.171
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable UTP-glucose-1-phosphate uridylyltransferase 2
    Species: Arabidopsis thaliana
    Gene: At3g03250, T17B22.6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2q4ja1, d2q4ja2
  • Chain 'B':
    Compound: Probable UTP-glucose-1-phosphate uridylyltransferase 2
    Species: Arabidopsis thaliana
    Gene: At3g03250, T17B22.6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2q4jb1, d2q4jb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4jA (A:)
    maattenlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpy
    ekmtpvsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqien
    lnnkygckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskg
    ktdkegwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnk
    neycmevtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvn
    lkaikklveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvk
    assdlllvqsdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveld
    slkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4jA (A:)
    enlpqlksavdgltemseseksgfislvsrylsgiewskiqtptdeivvpyekmtpvsqd
    vaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckv
    plvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyp
    pghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtp
    ktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklve
    adalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvq
    sdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvw
    fgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4jB (B:)
    maattenlpqlksavdgltemseseksgfislvsrylsgeaqhiewskiqtptdeivvpy
    ekmtpvsqdvaetknlldklvvlklngglgttmgctgpksvievrdgltfldliviqien
    lnnkygckvplvlmnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskg
    ktdkegwyppghgdvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnk
    neycmevtpktladvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvn
    lkaikklveadalkmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvk
    assdlllvqsdlytlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveld
    slkvsgdvwfgssivlkgkvtvaaksgvkleipdravvenkningpedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4jB (B:)
    lpqlksavdgltemseseksgfislvsryliewskiqtptdeivvpyekmtpvsqdvaet
    knlldklvvlklngglgttmgctgpksvievrdgltfldliviqienlnnkygckvplvl
    mnsfnthddthkivekytnsnvdihtfnqskyprvvadefvpwpskgktdkegwyppghg
    dvfpalmnsgkldtflsqgkeyvfvansdnlgaivdltilkhliqnkneycmevtpktla
    dvkggtlisyegkvqlleiaqvpdehvnefksiekfkifntnnlwvnlkaikklveadal
    kmeiipnpkevdgvkvlqletaagaairffdnaigvnvprsrflpvkassdlllvqsdly
    tlvdgfvtrnkartnpsnpsielgpefkkvatflsrfksipsiveldslkvsgdvwfgss
    ivlkgkvtvaaksgvkleipdravvenkningped