PDB entry 2q4i

View 2q4i on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of allene oxide cyclase from Arabidopsis thaliana At3g25770
Class: isomerase
Keywords: Ensemble Refinement, Refinement Methodology Development, AT3G25770, jasmonic acid biosynthesis, plant protein, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, ISOMERASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.132
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AOC2, At3g25770, K13N2_9, K13N2.11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-192)
      • modified residue (46)
    Domains in SCOPe 2.08: d2q4ia_
  • Chain 'B':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AOC2, At3g25770, K13N2_9, K13N2.11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-192)
      • modified residue (46)
    Domains in SCOPe 2.08: d2q4ib_
  • Chain 'C':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AOC2, At3g25770, K13N2_9, K13N2.11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-192)
      • modified residue (46)
    Domains in SCOPe 2.08: d2q4ic_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4iA (A:)
    stasralsqngnienprpskvqelsvyeineldrhspkilknafslmfglgdlvpftnkl
    ytgdlkkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflai
    tggagifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeak
    alepsgvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4iA (A:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4iB (B:)
    stasralsqngnienprpskvqelsvyeineldrhspkilknafslmfglgdlvpftnkl
    ytgdlkkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflai
    tggagifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeak
    alepsgvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4iB (B:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q4iC (C:)
    stasralsqngnienprpskvqelsvyeineldrhspkilknafslmfglgdlvpftnkl
    ytgdlkkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflai
    tggagifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeak
    alepsgvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4iC (C:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn