PDB entry 2q4f

View 2q4f on RCSB PDB site
Description: Ensemble refinement of the crystal structure of putative histidine-containing phosphotransfer protein from rice, Ak104879
Class: signaling protein
Keywords: Ensemble Refinement, Refinement Methodology Development, AK104879, PHOSPHORELAY MEDIATOR, HP1, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, SIGNALING PROTEIN
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.145
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine-containing phosphotransfer protein 1
    Species: Oryza sativa [TaxId:4530]
    Gene: HP1, AK104879, Os09g0567400, LOC_Os09g39400, OJ1155_H10.30
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6VAK4 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.03: d2q4fa_
  • Chain 'B':
    Compound: Histidine-containing phosphotransfer protein 1
    Species: Oryza sativa [TaxId:4530]
    Gene: HP1, AK104879, Os09g0567400, LOC_Os09g39400, OJ1155_H10.30
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2q4fb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4fA (A:)
    saaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriine
    iatlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavv
    rndfydlrnkfqtmlqleqqiqaydpkqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4fA (A:)
    saaaalrdqltallssmfsqglvdeqfqqlqmlqdtpgfvsevvtlfcddadriineiat
    lleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrnd
    fydlrnkfqtmlqleqqiqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4fB (B:)
    saaaalrdqltallssmfsqglvdeqfqqlqmlqdeggtpgfvsevvtlfcddadriine
    iatlleqpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavv
    rndfydlrnkfqtmlqleqqiqaydpkqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4fB (B:)
    aaalrdqltallssmfsqglvdeqfqqlqmlqdpgfvsevvtlfcddadriineiatlle
    qpvvnfdkvdayvhqlkgssasvgaqkvkftcmqfrqfcqdksrdgclmalavvrndfyd
    lrnkfqtmlqleqqiq