PDB entry 2q4e

View 2q4e on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At4g09670
Class: oxidoreductase
Keywords: Ensemble Refinement, Refinement Methodology Development, AT4G09670, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, OXIDOREDUCTASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable oxidoreductase At4g09670
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g09670, F17A8.20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SZ83
      • modified residue (11)
      • modified residue (105)
      • modified residue (125)
      • modified residue (129)
      • modified residue (248)
      • modified residue (309)
    Domains in SCOPe 2.07: d2q4ea1, d2q4ea2
  • Chain 'B':
    Compound: Probable oxidoreductase At4g09670
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g09670, F17A8.20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SZ83
      • modified residue (11)
      • modified residue (105)
      • modified residue (125)
      • modified residue (129)
      • modified residue (248)
      • modified residue (309)
    Domains in SCOPe 2.07: d2q4eb1, d2q4eb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4eA (A:)
    satetqirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkih
    gsyeslledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdacea
    ngvqimdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgld
    glgalgdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiy
    csflanltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtv
    ktelpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyqqisls
    gr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4eA (A:)
    qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
    lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
    mdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgal
    gdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsfla
    nltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktelp
    qeacmvrefarlvywpsisrktqlvvdavkesvdknyqqisls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4eB (B:)
    satetqirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkih
    gsyeslledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdacea
    ngvqimdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgld
    glgalgdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiy
    csflanltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtv
    ktelpqeacmvrefarlvgeiknngakpdgywpsisrktqlvvdavkesvdknyqqisls
    gr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4eB (B:)
    qirigvmgcadiarkvsraihlapnatisgvasrslekakafatannypestkihgsyes
    lledpeidalyvplptslhvewaikaaekgkhillekpvamnvtefdkivdaceangvqi
    mdgtmwvhnprtallkeflsdserfgqlktvqscfsfagdedflkndirvkpgldglgal
    gdagwyairatllannfelpktvtafpgavlneagvilscgaslswedgrtatiycsfla
    nltmeitaigtkgtlrvhdfiipyketeasfttstkawfndlvtawvsppsehtvktelp
    qeacmvrefaiknngakpdgywpsisrktqlvvdavkesvdknyqqisls