PDB entry 2q4b

View 2q4b on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of selenomethionyl gene product from Arabidopsis thaliana At5g02240 in space group P21212
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, NADP, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At5g02240
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240, T7H20_290
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • expression tag (0)
    Domains in SCOPe 2.06: d2q4ba2, d2q4ba3
  • Chain 'B':
    Compound: Protein At5g02240
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240, T7H20_290
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • expression tag (0)
    Domains in SCOPe 2.06: d2q4bb2, d2q4bb3
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q4bA (A:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4bA (A:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivv
    vgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvg
    kddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvt
    srf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q4bB (B:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q4bB (B:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpefifedgqypeqvdwigqknqidaakvagvkhivv
    vgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldkeggvrellvg
    kddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptkdfkalfsqvt
    srf