PDB entry 2q48

View 2q48 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g48480
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT5G48480, REDUCTIVELY METHYLATED PROTEIN, CATH 3.10.180 FOLD, UNKNOWN FUNCTION, DIMER, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At5g48480
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g48480, MJE7.12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LV66
      • modified residue (28)
    Domains in SCOPe 2.08: d2q48a_
  • Chain 'B':
    Compound: Protein At5g48480
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g48480, MJE7.12
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LV66
      • modified residue (28)
    Domains in SCOPe 2.08: d2q48b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q48A (A:)
    maqedvtavatngagpvethlvftefkqmllveaqkvgdavtfyksafgaiesghslypk
    rkldqelphvlsselnlagssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakav
    dagavkvevteaevelgfkgkvtdpfgvtwifaekktvitdenkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q48A (A:)
    hlvftefkqmllveaqkvgdavtfyksafgaieshvlsselnlagssfvvcdvsslpgfs
    taksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwifae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q48B (B:)
    maqedvtavatngagpvethlvftefkqmllveaqkvgdavtfyksafgaiesghslypk
    rkldqelphvlsselnlagssfvvcdvsslpgfstaksegsgvtfllgtkdaeaavakav
    dagavkvevteaevelgfkgkvtdpfgvtwifaekktvitdenkev
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q48B (B:)
    vftefkqmllveaqkvgdavtfyksafgaiesghslhvlsselnlagssfvvcdvsslpg
    fstaksegsgvtfllgtkdaeaavakavdagavkvevteaevelgfkgkvtdpfgvtwif
    ae