PDB entry 2q47

View 2q47 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of a putative phosphoprotein phosphatase from Arabidopsis thaliana gene At1g05000
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT1G05000, phosphoprotein phosphatase, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.16
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable tyrosine-protein phosphatase At1g05000
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At1g05000, T7A14.14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ZVN4 (0-150)
    • modified residue (9)
    • modified residue (81)
    • modified residue (143)
  Domains in SCOPe 2.01: d2q47a1
• Chain 'B':
  Compound: Probable tyrosine-protein phosphatase At1g05000
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At1g05000, T7A14.14
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ZVN4 (0-150)
    • modified residue (9)
    • modified residue (81)
    • modified residue (143)
  Domains in SCOPe 2.01: d2q47b1
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q47A (A:)
  hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
  fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
  ltsifdeyqrfaaakarvsdqrfmeifdvss
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q47B (B:)
  hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
  fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
  ltsifdeyqrfaaakarvsdqrfmeifdvss