PDB entry 2q46

View 2q46 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At5g02240
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT5G02240, NADP, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At5g02240
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240, T7H20_290
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • expression tag (0)
    Domains in SCOPe 2.07: d2q46a2, d2q46a3
  • Chain 'B':
    Compound: Protein At5g02240
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g02240, T7H20_290
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94EG6 (1-252)
      • expression tag (0)
    Domains in SCOPe 2.07: d2q46b2, d2q46b3
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q46A (A:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q46B (B:)
    sanlptvlvtgasgrtgqivykklkegsdkfvakglvrsaqgkekiggeadvfigditda
    dsinpafqgidalviltsavpkmkpgfdptkggrpefifedgqypeqvdwigqknqidaa
    kvagvkhivvvgsmggtnpdhplnklgngnilvwkrkaeqyladsgtpytiiragglldk
    eggvrellvgkddellqtdtktvpradvaevciqallfeeaknkafdlgskpegtstptk
    dfkalfsqvtsrf