PDB entry 2q45

View 2q45 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of putative tropinone reductase from Arabidopsis thaliana gene At1g07440
Class: oxidoreductase
Keywords: Ensemble Refinement, Refinement Methodology Development, AT1G07440, REDUCTIVELY METHYLATED PROTEIN, PUTATIVE TROPINONE REDUCTASE, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, OXIDOREDUCTASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.234
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative tropinone reductase homolog At1g07440
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1g07440, F22G5_16, F22G5.20, F22G5.39
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q45a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q45A (A:)
    magaeqsqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqk
    kgfqvtgsvcdaslrpereklmqtvssmfggkldilinnlgairskptldytaedfsfhi
    stnlesayhlsqlahpllkasgcgniifmssiagvvsasvgsiysatkgalnqlarnlac
    ewasdgiranavapaviatplaeavyddefkkvvisrkplgrfgepeevsslvaflcmpa
    asyitgqticvdggltvngfsyqpqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q45A (A:)
    sqrwslkaktvlvtggtkgighaiveefagfgavihtcarneyelneclskwqkkgfqvt
    gsvcdaslrpereklmqtvssmfggkldilinnlgaldytaedfsfhistnlesayhlsq
    lahpllkasgcgniifmsgsiysatkgalnqlarnlacewasdgiranavapaviagepe
    evsslvaflcmpaasyitgqticvdggltvngfsyqpq