PDB entry 2q44

View 2q44 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At1g77540
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, AT1G77540, PUTATIVE ACETYLTRANSFERASE, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2007-06-19, with a file datestamp of 2007-06-15.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.165
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein At1g77540
    Species: Arabidopsis thaliana
    Gene: At1g77540, T5M16.13
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2q44a1
  • Heterogens: BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q44A (A:)
    sateppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcva
    afehasshsisiipscsyvsdtflprnpswkplihsevfkssi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q44A (A:)
    ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh
    asshsisiipscsyvsdtflprnpswkplihsevf