PDB entry 2q43

View 2q43 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of IAA-aminoacid hydrolase from Arabidopsis thaliana gene At5g56660
Class: hydrolase
Keywords: Ensemble Refinement, Refinement Methodology Development, AT5G56660, ILL2, indole-3-acetic acid, auxin, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IAA-amino acid hydrolase ILR1-like 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ILL2, At5g56660, MIK19.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2q43a1, d2q43a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q43A (A:)
    sespwiaedtsqiqtkllefakspevfdwmvkirrkihenpelgyeeletsklirselel
    igikyrypvaitgvigyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdg
    hvtmllgaakilhehrhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsar
    ipfgkaasragsflagagvfeavitgkgghaaipqhtidpvvaassivlslqqlvsretd
    pldskvvtvskvnggnafnvipdsitiggtlraftgftqlqqrvkevitkqaavhrcnas
    vnltpngrepmpptvnnkdlykqfkkvvrdllgqeafveaapvmgsedfsyfaetipghf
    sllgmqdetngyasshsplyrinedvlpygaaihasmavqylkekaskgsvsgfheel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q43A (A:)
    kllefakspevfdwmvkirrkihenpelgyeeletsklirseleligikyrypvaitgvi
    gyigtgeppfvalradmdalpiqegvewehkskiagkmhacghdghvtmllgaakilheh
    rhhlqgtvvlifqpaeeglsgakkmreegalknveaifgihlsaripfgkaasragsfla
    gagvfeavitgktidpvvaassivlslqqlvsretdpldskvvtvskvnpdsitiggtlr
    aftgftqlqqrvkevitkqaavhrcnasvnltpngrepmpptvnnkdlykqfkkvvrdll
    gqeafveaapvmgsedfsyfaetipghfsllgmqdetngyasshsplyrinedvlpygaa
    ihasmavqylkekas