PDB entry 2q42

View 2q42 on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of glyoxalase II from Arabidopsis thaliana gene At2g31350
Class: hydrolase
Keywords: Ensemble Refinement, Refinement Methodology Development, AT2G31350, METALLO-HYDROLASE, ZINC/IRON BINUCLEAR CENTER, B-LACTAMASE FOLD, THIOESTER HYDROLASE, mitochondrial isozyme, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, HYDROLASE
Deposited on 2007-05-31, released 2007-06-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.147
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative hydroxyacylglutathione hydrolase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g31350, T28P16.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SID3 (1-253)
      • initiating methionine (0)
    Domains in SCOPe 2.02: d2q42a_
  • Chain 'B':
    Compound: Putative hydroxyacylglutathione hydrolase 2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g31350, T28P16.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SID3 (1-253)
      • initiating methionine (0)
    Domains in SCOPe 2.02: d2q42b_
  • Heterogens: ZN, FE, ACY, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q42A (A:)
    mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
    ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
    fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
    slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
    aealgiirkakddf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q42B (B:)
    mqielvpclkdnyayilhdedtgtvgvvdpseaepiidslkrsgrnltyilnthhhydht
    ggnlelkdrygakvigsamdkdripgidmalkdgdkwmfaghevhvmdtpghtkghisly
    fpgsraiftgdtmfslscgklfegtpkqmlaslqkitslpddtsiycgheytlsnskfal
    slepnnevlqsyaahvaelrskklptipttvkmekacnpflrssntdirralripeaade
    aealgiirkakddf