PDB entry 2q3w

View 2q3w on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of the cys84ala cys85ala double mutant of the [2Fe-2S] ferredoxin subunit of toluene-4-monooxygenase from Pseudomonas mendocina KR1
Class: electron transport
Keywords: Ensemble Refinement, Refinement Methodology Development, FERREDOXIN, FES, [2FE-2S] CLUSTER, RIESKE PROTEIN, TOLUENE-4-MONOOXYGENASE SUBUNIT, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, ELECTRON TRANSPORT
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.144
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Toluene-4-monooxygenase system ferredoxin subunit
  Species: PSEUDOMONAS MENDOCINA [TaxId:300]
  Gene: tmoC
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00458 (0-End)
    • engineered (82-83)
  Domains in SCOPe 2.07: d2q3wa_
• Heterogens: MG, FES, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2q3wA (A:)
  sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
  itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2q3wA (A:)
  sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
  itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka