PDB entry 2q3w
View 2q3w on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of the cys84ala cys85ala double mutant of the [2Fe-2S] ferredoxin subunit of toluene-4-monooxygenase from Pseudomonas mendocina KR1
Class: electron transport
Keywords: Ensemble Refinement, Refinement Methodology Development, FERREDOXIN, FES, [2FE-2S] CLUSTER, RIESKE PROTEIN, TOLUENE-4-MONOOXYGENASE SUBUNIT, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, ELECTRON TRANSPORT
Deposited on
2007-05-30, released
2007-06-19
The last revision prior to the SCOP 1.75 freeze date was dated
2007-10-02, with a file datestamp of
2007-09-28.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.144
AEROSPACI score: 0.72
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Toluene-4-monooxygenase system ferredoxin subunit
Species: Pseudomonas mendocina
Gene: tmoC
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d2q3wa1 - Heterogens: MG, FES, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2q3wA (A:)
sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnkahs
Sequence, based on observed residues (ATOM records): (download)
>2q3wA (A:)
sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka