PDB entry 2q3v

View 2q3v on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At2g34160
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, At2g34160, Unknown Function, Nitrate, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein At2g34160
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g34160, T14G11.28
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22969
      • modified residue (42)
      • modified residue (55)
      • modified residue (79)
      • engineered (82)
      • modified residue (113)
    Domains in SCOPe 2.07: d2q3va_
  • Chain 'B':
    Compound: Protein At2g34160
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g34160, T14G11.28
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22969
      • modified residue (42)
      • modified residue (55)
      • modified residue (79)
      • engineered (82)
      • modified residue (113)
    Domains in SCOPe 2.07: d2q3vb_
  • Heterogens: K, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q3vA (A:)
    seeitdgvnnmnlatdsqkknriqvsntkkplffyvnlakrymqqyndvelsalgmaiat
    vvtvteilknngfavekkimtsivdikddargrpvqkakieitlvksekfdelmaaanee
    kedaetqvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3vA (A:)
    kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
    imtsivdikpvqkakieitlvksekfdelmaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q3vB (B:)
    seeitdgvnnmnlatdsqkknriqvsntkkplffyvnlakrymqqyndvelsalgmaiat
    vvtvteilknngfavekkimtsivdikddargrpvqkakieitlvksekfdelmaaanee
    kedaetqvqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3vB (B:)
    knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki
    mtsivdikddargrpvqkakieitlvksekfdelmaaaneeke