PDB entry 2q3t

View 2q3t on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of gene product from Arabidopsis thaliana At3g22680
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, UNKNOWN FUNCTION, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.139
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein At3g22680
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At3g22680, MWI23.5
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9LUJ3
  Domains in SCOPe 2.08: d2q3ta_
• Heterogens: SO4, CPS, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2q3tA (A:)
  selrpsgdsgssdvdaeisdgfspldtshrdvadegsllrraemyqdymkqvpiptnrgs
  lipftswvglsismkqlygqplhyltnvllqrwdqsrfgtdseeqrldsiihptkaeati
  wlveeihrltpshlhmallwrsdpmyhsfidpifpek
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2q3tA (A:)
  gsllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdq
  srfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp
  e