PDB entry 2q3p

View 2q3p on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of At3g17210 from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein At3g17210
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: At3g17210
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q0WKU8 (Start-111)
    • modified residue (44)
  Domains in SCOPe 2.06: d2q3pa_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2q3pA (A:)
  gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
  qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2q3pA (A:)
  pvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifes
  tfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl