PDB entry 2q3p
View 2q3p on RCSB PDB site
Description: Ensemble refinement of the protein crystal structure of At3g17210 from Arabidopsis thaliana
Class: structural genomics, unknown function
Keywords: Ensemble Refinement, Refinement Methodology Development, Structural Genomics, Protein Structure Initiative, PSI, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on
2007-05-30, released
2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-08-10, with a file datestamp of
2011-08-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.49
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Uncharacterized protein At3g17210
Species: Arabidopsis thaliana [TaxId:3702]
Gene: At3g17210
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d2q3pa_ - Heterogens: MG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2q3pA (A:)
gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
Sequence, based on observed residues (ATOM records): (download)
>2q3pA (A:)
pvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifes
tfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl