PDB entry 2q3j

View 2q3j on RCSB PDB site
Description: Crystal structure of the His183Ala variant of Bacillus subtilis ferrochelatase in complex with N-Methyl Mesoporphyrin
Class: lyase
Keywords: ROSSMANN FOLD; PI-HELIX; N-METHYL MESOPORPHYRIN IX; N-MeMP, LYASE
Deposited on 2007-05-30, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.183
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hemH, hemF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32396 (Start-308)
      • engineered (181)
    Domains in SCOPe 2.07: d2q3ja_
  • Heterogens: MG, H02, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q3jA (A:)
    srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
    qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
    vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
    aaslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
    lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
    tvvlkklgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3jA (A:)
    kmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqqa
    hnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvqs
    ynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsaas
    lpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlfe
    qkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatvv
    lkklgr