PDB entry 2q3h

View 2q3h on RCSB PDB site
Description: The crystal structure of RhouA in the GDP-bound state.
Class: structural genomics
Keywords: GTPase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras homolog gene family, member U
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOU
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPY5
      • conflict (161)
    Domains in SCOPe 2.06: d2q3ha_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q3hA (A:)
    smgpgepggrgraggaegrgvkcvlvgdgavgktslvvsyttngypteyiptafdnfsav
    vsvdgrpvrlqlcdtagqdefdklrplcytntdifllcfsvvspssfqnvsekwvpeirc
    hcpkapiilvgtqsdlredvkvlieldkckekpvpeeaakllaeeikaasyiecsaltqk
    nlkevfdaaivagiqysdtqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3hA (A:)
    gvkcvlvgdgavgktslvvsyttptafdnfsavvsvdgrpvrlqlcdtagqdefdklrpl
    cytntdifllcfsvvspssfqnvsekwvpeirchcpkapiilvgtqsdlredvkvlield
    kckekpvpeeaakllaeeikaasyiecsaltqknlkevfdaaivagiqysd