PDB entry 2q3g

View 2q3g on RCSB PDB site
Description: Structure of the PDZ domain of human PDLIM7 bound to a C-terminal extension from human beta-tropomyosin
Class: structural genomics
Keywords: Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: 0.133
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PDZ and LIM domain protein 7
  Species: Homo sapiens [TaxId:9606]
  Gene: PDLIM7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NR12 (1-84)
    • cloning artifact (0)
    • cloning artifact (85-88)
  Domains in SCOPe 2.06: d2q3ga1, d2q3ga2, d2q3ga3
• Chain 'B':
  Compound: PDZ and LIM domain protein 7
  Species: Homo sapiens [TaxId:9606]
  Gene: PDLIM7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NR12 (1-84)
    • cloning artifact (85-88)
  Domains in SCOPe 2.06: d2q3gb1, d2q3gb2
• Heterogens: CL, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q3gA (A:)
  smdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenag
  slthieaqnkiracgerlslglsraitsl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2q3gB (B:)
  smdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenag
  slthieaqnkiracgerlslglsraitsl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2q3gB (B:)
  mdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenags
  lthieaqnkiracgerlslglsraitsl