PDB entry 2q3g

View 2q3g on RCSB PDB site
Description: Structure of the PDZ domain of human PDLIM7 bound to a C-terminal extension from human beta-tropomyosin
Class: structural genomics
Keywords: Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-05-30, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: XRAY
Resolution: 1.11 Å
R-factor: N/A
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PDZ and LIM domain protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: PDLIM7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NR12 (1-84)
      • cloning artifact (0)
      • cloning artifact (85-88)
    Domains in SCOPe 2.08: d2q3ga1, d2q3ga2, d2q3ga3
  • Chain 'B':
    Compound: PDZ and LIM domain protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: PDLIM7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NR12 (1-84)
      • cloning artifact (85-88)
    Domains in SCOPe 2.08: d2q3gb1, d2q3gb2
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q3gA (A:)
    smdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenag
    slthieaqnkiracgerlslglsraitsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q3gB (B:)
    smdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenag
    slthieaqnkiracgerlslglsraitsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q3gB (B:)
    mdsfkvvlegpapwgfrlqggkdfnvplsisrltpggkaaqagvavgdwvlsidgenags
    lthieaqnkiracgerlslglsraitsl