PDB entry 2q35

View 2q35 on RCSB PDB site
Description: Crystal Structure of the Y82F variant of ECH2 decarboxylase domain of CurF from Lyngbya majuscula
Class: lyase
Keywords: crotonase, lyase
Deposited on 2007-05-29, released 2007-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CurF
    Species: Lyngbya majuscula [TaxId:276768]
    Gene: curF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DNE7 (2-242)
      • expression tag (0-1)
      • engineered (67)
    Domains in SCOPe 2.07: d2q35a1, d2q35a2
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q35A (A:)
    navvqltelgngvvqitmkdessrngfspsiveglrhcfsvvaqnqqykvviltgygnyf
    ssgaskeflirktrgevevldlsglildceipiiaamqghsfggglllglyadfvvfsqe
    svyatnfmkygftpvgatslilreklgselaqemiytgenyrgkelaergipfpvvsrqd
    vlnyaqqlgqkiaksprlslvalkqhlsadikakfpeaikkeleihqvtfnqpeiasriq
    qef