PDB entry 2q33

View 2q33 on RCSB PDB site
Description: Crystal structure of all-D monellin at 1.8 A resolution
Class: de novo protein
Keywords: alpha/beta, all-d protein, de novo protein
Deposited on 2007-05-29, released 2007-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-monellin chain a
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q33 (0-42)
    Domains in SCOPe 2.06: d2q33.1
  • Chain 'B':
    Compound: d-monellin chain b
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q33 (0-47)
    Domains in SCOPe 2.06: d2q33.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q33A (A:)
    eikgyeyqlyvyasdklfradisedyktrgrkllrfngpvppp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q33B (B:)
    geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcxkktiye