PDB entry 2q2z

View 2q2z on RCSB PDB site
Description: Crystal Structure of KSP in Complex with Inhibitor 22
Class: cell cycle
Keywords: KSP, KSP-inhibitor complex, CELL CYCLE
Deposited on 2007-05-29, released 2007-09-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.194
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2q2za1
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: Homo sapiens [TaxId:9606]
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2q2zb1
  • Heterogens: MG, ADP, MKK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q2zA (A:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2zA (A:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q2zB (B:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2zB (B:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk