PDB entry 2q2y

View 2q2y on RCSB PDB site
Description: Crystal Structure of KSP in complex with Inhibitor 1
Class: cell cycle
Keywords: KSP, KSP-inhibitor complex, CELL CYCLE
Deposited on 2007-05-29, released 2007-09-18
The last revision prior to the SCOP 1.75 freeze date was dated 2007-10-09, with a file datestamp of 2007-10-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kinesin-like protein KIF11
    Species: HOMO SAPIENS
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2q2ya1
  • Chain 'B':
    Compound: Kinesin-like protein KIF11
    Species: HOMO SAPIENS
    Gene: KIF11, EG5, KNSL1, TRIP5
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2q2yb1
  • Heterogens: MG, ADP, MKR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q2yA (A:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2yA (A:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q2yB (B:)
    asqpnssakkkeekgkniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladks
    srktytfdmvfgastkqidvyrsvvcpildevimgynctifaygqtgtgktftmegersp
    neeytweedplagiiprtlhqifekltdngtefsvkvslleiyneelfdllnpssdvser
    lqmfddprnkrgviikgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsv
    tihmkettidgeelvkigklnlvdlagsenigrsgavdkrareagninqslltlgrvita
    lvertphvpyreskltrilqdslggrtrtsiiatispaslnleetlstleyahrakniln
    kpevnqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2yB (B:)
    niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
    qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
    rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
    gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
    igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
    iatispaslnleetlstleyahraknilnk