PDB entry 2q2x

View 2q2x on RCSB PDB site
Description: Crystal Structure of the ECH2 decarboxylase domain of CurF from Lyngbya majuscula
Class: lyase
Keywords: crotonase, lyase
Deposited on 2007-05-29, released 2007-10-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CurF
    Species: Lyngbya majuscula [TaxId:276768]
    Gene: curF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DNE7 (2-242)
      • expression tag (1)
      • modified residue (17)
      • modified residue (96)
      • modified residue (127)
      • modified residue (153)
    Domains in SCOPe 2.06: d2q2xa1, d2q2xa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q2xA (A:)
    navvqltelgngvvqitmkdessrngfspsiveglrhcfsvvaqnqqykvviltgygnyf
    ssgaskeylirktrgevevldlsglildceipiiaamqghsfggglllglyadfvvfsqe
    svyatnfmkygftpvgatslilreklgselaqemiytgenyrgkelaergipfpvvsrqd
    vlnyaqqlgqkiaksprlslvalkqhlsadikakfpeaikkeleihqvtfnqpeiasriq
    qef
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2xA (A:)
    avvqltelgngvvqitmkdessrngfspsiveglrhcfsvvaqnqqykvviltgygnyfs
    sgaskeylirktrgevevldlsglildceipiiaamqghsfggglllglyadfvvfsqes
    vyatnfmkygftpvgatslilreklgselaqemiytgenyrgkelaergipfpvvsrqdv
    lnyaqqlgqkiaksprlslvalkqhlsadikakfpeaikkeleihqvtfnqpeiasriqq
    ef