PDB entry 2q2w

View 2q2w on RCSB PDB site
Description: Structure of D-3-Hydroxybutyrate Dehydrogenase from Pseudomonas putida
Class: Oxidoreductase
Keywords: Pseudomonas putida, D-3-Hydroxybutyrate Dehydrogenase, Oxidoreductase
Deposited on 2007-05-29, released 2007-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.184
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2wa_
  • Chain 'B':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2wb_
  • Chain 'C':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2wc_
  • Chain 'D':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2wd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q2wA (A:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2wA (A:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddrnggdplqaqhdllaekqpslafvtpehlgelvlflcseagsqvr
    gaawnvdggwlaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q2wB (B:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q2wC (C:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2wC (C:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddggdplqaqhdllaekqpslafvtpehlgelvlflcseagsqvrga
    awnvdggwlaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q2wD (D:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2wD (D:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddplqaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaawn
    vdggwlaq