PDB entry 2q2v

View 2q2v on RCSB PDB site
Description: Structure of D-3-Hydroxybutyrate Dehydrogenase from Pseudomonas putida
Class: oxidoreductase
Keywords: D-3-Hydroxybutyrate Dehydrogenase, Pseudomonas putida, SDR, Oxidoreductase
Deposited on 2007-05-29, released 2007-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q2va_
  • Chain 'B':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q2vb_
  • Chain 'C':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q2vc_
  • Chain 'D':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2q2vd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q2vA (A:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q2vB (B:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2vB (B:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraagdplqaqhdllaekqpslafvtpehlgelvlflcseagsqvr
    gaawnvdggwlaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q2vC (C:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2vC (C:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddrlqaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaawn
    vdggwlaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2q2vD (D:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2vD (D:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddrqaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaawnv
    dggwlaq