PDB entry 2q2q

View 2q2q on RCSB PDB site
Description: Structure of D-3-Hydroxybutyrate Dehydrogenase from Pseudomonas putida
Class: Oxidoreductase
Keywords: Pseudomonas putida, SDR, Oxidoreductase
Deposited on 2007-05-29, released 2007-10-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qa_
  • Chain 'B':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qb_
  • Chain 'C':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qc_
  • Chain 'D':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qd_
  • Chain 'E':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qe_
  • Chain 'F':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qf_
  • Chain 'G':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qg_
  • Chain 'H':
    Compound: Beta-D-hydroxybutyrate dehydrogenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: bdhA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2q2qh_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q2qA (A:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2qA (A:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddrdplqaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaa
    wnvdggwlaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q2qB (B:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2qB (B:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddragdplqaqhdllaekqpslafvtpehlgelvlflcseagsqvrg
    aawnvdggwlaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2q2qC (C:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2qC (C:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaawnvdggw
    laq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q2qD (D:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2q2qE (E:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2qE (E:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddralqaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaaw
    nvdggwlaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2q2qF (F:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2qF (F:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaawnvdggwlaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2q2qG (G:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2qG (G:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraaplqaqhdllaekqpslafvtpehlgelvlflcseagsqvrga
    awnvdggwlaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2q2qH (H:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltplvqkqiddraanggdplqaqhdllaekqpslafvtpehlgelvlflcseagsq
    vrgaawnvdggwlaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2qH (H:)
    tlkgktalvtgstsgiglgiaqvlaraganivlngfgdpapalaeiarhgvkavhhpadl
    sdvaqiealfalaerefggvdilvnnagiqhvapveqfpleswdkiialnlsavfhgtrl
    alpgmrarnwgriiniasvhglvgstgkaayvaakhgvvgltkvvgletatsnvtcnaic
    pgwvltpplqaqhdllaekqpslafvtpehlgelvlflcseagsqvrgaawnvdggwlaq