PDB entry 2q2o

View 2q2o on RCSB PDB site
Description: Crystal structure of H183C Bacillus subtilis ferrochelatase in complex with deuteroporphyrin IX 2,4-disulfonic acid dihydrochloride
Class: lyase
Keywords: rossmann fold; pi-helix, lyase
Deposited on 2007-05-29, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.186
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: hemH, hemF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32396 (Start-308)
      • engineered (181)
    Domains in SCOPe 2.07: d2q2oa_
  • Heterogens: MG, H01, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q2oA (A:)
    srkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqite
    qqahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfs
    vqsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivs
    acslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrd
    lfeqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidala
    tvvlkklgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2oA (A:)
    kkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqq
    ahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvq
    synkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsac
    slpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlf
    eqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatv
    vlkklgr