PDB entry 2q2l

View 2q2l on RCSB PDB site
Description: Crystal Structure of Superoxide Dismutase from P. atrosanguina
Class: oxidoreductase
Keywords: SOD; SAD; Antioxidant; Oxidoreductase; Metal-Binding
Deposited on 2007-05-29, released 2008-03-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.167
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Potentilla atrosanguinea [TaxId:487759]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q2L (0-151)
    Domains in SCOPe 2.01: d2q2la_
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Potentilla atrosanguinea [TaxId:487759]
    Database cross-references and differences (RAF-indexed):
    • PDB 2Q2L (0-151)
    Domains in SCOPe 2.01: d2q2lb_
  • Heterogens: ZN, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q2lA (A:)
    makgvavlsssegvagtilftqegdgpttvtgnisglkpglhgfhvhalgdttngcmstg
    phfnpagkehgspedetrhagdlgnitvgddgtacftivdkqipltgphsiigravvvha
    dpddlgkgghelskstgnaggriacgiiglqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2q2lB (B:)
    makgvavlsssegvagtilftqegdgpttvtgnisglkpglhgfhvhalgdttngcmstg
    phfnpagkehgspedetrhagdlgnitvgddgtacftivdkqipltgphsiigravvvha
    dpddlgkgghelskstgnaggriacgiiglqg