PDB entry 2q2i

View 2q2i on RCSB PDB site
Description: Crystal structure of the protein secretion chaperone CsaA from Agrobacterium tumefaciens.
Class: chaperone
Keywords: beta barrel, OB fold, homodimer, chaperone, protein secretion
Deposited on 2007-05-28, released 2008-04-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.18
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secretion chaperone
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: csaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2q2ia_
  • Chain 'B':
    Compound: Secretion chaperone
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: csaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2q2ib_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2q2iA (A:)
    gshmsgeisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitvhy
    tpeslvgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2iA (A:)
    sgeisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitvhytpes
    lvgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2q2iB (B:)
    gshmsgeisyadfekvdirvgtiveavpfpearkpaikvkidfgpeigikkssaqitvhy
    tpeslvgrqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2q2iB (B:)
    sgeisyadfekvdirvgtiveavpfpepaikvkidfgpeigikkssaqitvhytpeslvg
    rqvlgvvnfpprqigpfrsevltlgfadangdivlaaverpvpngekmc