PDB entry 2q21

View 2q21 on RCSB PDB site
Description: crystal structures at 2.2 angstroms resolution of the catalytic domains of normal ras protein and an oncogenic mutant complexed with gsp
Deposited on 1991-09-25, released 1992-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 1992-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d2q21__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2q21_ (-)
  mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqhklrkl